PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0198s0039.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 733aa    MW: 79562.8 Da    PI: 5.8926
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0198s0039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1016.8e-32313370260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                          +DgynWrKYGqK+vkgse+prsY+rCt+ +Cpvkkkvers+ ++ v+ei+Y+g Hnh+k
  Kalax.0198s0039.1.p 313 EDGYNWRKYGQKQVKGSEYPRSYFRCTHMNCPVKKKVERSH-EGIVTEIIYKGAHNHPK 370
                          8****************************************.9**************85 PP

2WRKY103.79.8e-33525583159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  Kalax.0198s0039.1.p 525 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCSVRKHVERASHDLKSVITTYEGKHNHD 583
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.225307371IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.7E-28310371IPR003657WRKY domain
SuperFamilySSF1182902.88E-25311371IPR003657WRKY domain
SMARTSM007745.3E-37312370IPR003657WRKY domain
PfamPF031063.5E-25313369IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.5E-37510585IPR003657WRKY domain
SuperFamilySSF1182902.09E-28517585IPR003657WRKY domain
PROSITE profilePS5081138.618520585IPR003657WRKY domain
SMARTSM007742.0E-37525584IPR003657WRKY domain
PfamPF031064.5E-25526583IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MDEHAAAMMG DWVPPSPSPK AFFSSLLGGD EQISTGPMPQ IPDEARNGGC SSFGSYQGGM  60
GFEDDNAKQR GISFENDLIF SPLPDHNKPT SRGGLVDRIA ARAGFNAPRL NTESIILTDR  120
SSTGEVKSPY FTIPTGISPT ALLESPVFLS NPLTQASPTT GKFPLFAFEN NISSMVAENA  180
QSKEDFFDDV DGSSFAFKPP AESGLSFSLG TTDKMNQLMN PQALPKIEVS VRSENFFRNS  240
EPSLIHSHEG GFSHSLTEKD LGEITAGSDI KGLDTISGTA EHSPPLGDQH DDEGDQRISS  300
DSYAGGSAGS LAEDGYNWRK YGQKQVKGSE YPRSYFRCTH MNCPVKKKVE RSHEGIVTEI  360
IYKGAHNHPK PAPNHRSSIG CNQLDDTHDQ VGLENCGDRD SVWGTAQNGL LPVTHEWRND  420
SFEHKSLSSM NSELRNPSSS LQMQNGAVVE SGDVVDPSST CSNDEEEDDR VTHGSVSIAN  480
DGEGDESESK RRKIETYAAE IGGGATRAIR EPRVVVQTTS DVDILDDGYR WRKYGQKVVK  540
GNPNPRSYYK CTSAGCSVRK HVERASHDLK SVITTYEGKH NHDVPAARNS SHVSSAAGGM  600
GSQSQSLIPR HEPSQVTSMA RYERQPHLSS FNLPMMQSLG APPHGFPTGV IQSSLANMSM  660
AGLGPGQNKF PGIPAYPYLM QQQQLQQRHV NDLSFMMPKG EAKVEPNSDP NVYHPNGSSV  720
YNRIVNRLPL GP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36311586878Probable WRKY transcription factor 4
2lex_A3e-36311586878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002265612.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_010644699.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_010644700.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLF6I4X40.0F6I4X4_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-164WRKY DNA-binding protein 2